Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus LMP1 protein

This Virus LMP1 protein spans the amino acid sequence from region 185-371aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein p63

UniProt

Q1HVB3

Expression Region

185-371aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVTGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTADNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2IRD1 siRNA (Human)
CRH6366-01 15 nmol

GTF2IRD1 siRNA (Human)

Sign In for Pricing
View Details
GTF2IRD1 siRNA (Human)
CRH6366-02 30 nmol

GTF2IRD1 siRNA (Human)

Sign In for Pricing
View Details
CSTA Recombinant Protein (Rat)
RP196598 100 µg

CSTA Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human Follistatin Like Protein 1 (FSTL1) ELISA Kit
orb1807520-01 48 Tests

Human Follistatin Like Protein 1 (FSTL1) ELISA Kit

Sign In for Pricing
View Details
Human Follistatin Like Protein 1 (FSTL1) ELISA Kit
orb1807520-02 96 Tests

Human Follistatin Like Protein 1 (FSTL1) ELISA Kit

Sign In for Pricing
View Details
MND1 3'UTR GFP Stable Cell Line
TU064411 1.0 mL

MND1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details