Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus LMP1 protein

This Virus LMP1 protein spans the amino acid sequence from region 185-371aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein p63

UniProt

Q1HVB3

Expression Region

185-371aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVTGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTADNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse CD5-BIOT
1547-08 0.5 mg

Rat Anti-Mouse CD5-BIOT

Sign In for Pricing
View Details
Agrin Rabbit Polyclonal Antibody (APC)
orb996860 100 µL

Agrin Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
MEX3B Protein Vector (Rat) (pPM-C-HA)
PV281984 500 ng

MEX3B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human IL-7 Protein
ABC-GF0006 10 μg, 100 μg, 1 mg

Recombinant Human IL-7 Protein

Sign In for Pricing
View Details
FRS2 (Fibroblast growth factor receptor substrate 2, FGFR substrate 2, FGFR-signaling adaptor SNT, Suc1-associated neurotrophic factor target 1, SNT-1)
316449 100 µL

FRS2 (Fibroblast growth factor receptor substrate 2, FGFR substrate 2, FGFR-signaling adaptor SNT, Suc1-associated neurotrophic factor target 1, SNT-1)

Sign In for Pricing
View Details
Epiregulin (EREG) BioAssayTM ECL ELISA Kit (Mouse)
157571 96 Tests

Epiregulin (EREG) BioAssayTM ECL ELISA Kit (Mouse)

Sign In for Pricing
View Details