Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus LMP1 protein

This Virus LMP1 protein spans the amino acid sequence from region 185-371aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein p63

UniProt

Q1HVB3

Expression Region

185-371aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVTGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTADNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT12 Protein Vector (Mouse) (pPB-C-His)
PV235814 500 ng

SYT12 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride
M28414-01 1 g

2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride
M28414-02 2 mg

2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride
M28414-03 5 mg

2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride
M28414-04 10 mg

2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride
M28414-05 25 mg

2- (5-methyl-1H-imidazol-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details