Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus LMP1 protein

This Virus LMP1 protein spans the amino acid sequence from region 185-371aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein p63

UniProt

Q1HVB3

Expression Region

185-371aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVTGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTADNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mi2-α Monoclonal Antibody
RA11665-01 50 µL

Mi2-α Monoclonal Antibody

Sign In for Pricing
View Details
Mi2-α Monoclonal Antibody
RA11665-02 100 µL

Mi2-α Monoclonal Antibody

Sign In for Pricing
View Details
RALGPS2 Rabbit Polyclonal Antibody (RBITC)
orb1079804 100 µL

RALGPS2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
UltraFidelityTM DNA Polymerase
K3108-100 100 U

UltraFidelityTM DNA Polymerase

Sign In for Pricing
View Details
STX4, ID (STX4, STX4A, Syntaxin-4, Renal carcinoma antigen NY-REN-31) (Biotin)
042440-Biotin 200 µL

STX4, ID (STX4, STX4A, Syntaxin-4, Renal carcinoma antigen NY-REN-31) (Biotin)

Sign In for Pricing
View Details
MAIP1 Rabbit Polyclonal Antibody
orb579755 100 µL

MAIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details