Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi mas5 protein

This Fungi mas5 protein spans the amino acid sequence from region 1-404aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mas5, SPBC1734.11, Mitochondrial protein import protein mas5

UniProt

O74752

Expression Region

1-404aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRWLTIPIIPGECIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPNFATPEQLALLEKALPPRKIESAPKNAHTEECVLATVDPTEKVRIDNNVDPTTATSMDEDEDEEGGHPGVQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-642b-3p miRNA Mimic
orb1877539-01 5 nmol

Hsa-miR-642b-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-642b-3p miRNA Mimic
orb1877539-02 10 nmol

Hsa-miR-642b-3p miRNA Mimic

Sign In for Pricing
View Details
VILIP3 (HPCAL1) (NM_134421) Human Recombinant Protein
TP303476M 100 µg

VILIP3 (HPCAL1) (NM_134421) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial (GEP7)
MBS7015516-01 0.02 mg

Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial (GEP7)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial (GEP7)
MBS7015516-02 0.1 mg

Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial (GEP7)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial (GEP7)
MBS7015516-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial (GEP7)

Sign In for Pricing
View Details