Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACTL8 protein

This Human ACTL8 protein spans the amino acid sequence from region 1-366aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 57 (CT57)

UniProt

Q9H568

Expression Region

1-366aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal mGluR1 Antibody [Alexa Fluor 405]
NB110-39033AF405 0.1 mL

Rabbit Polyclonal mGluR1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (MaxLight 405)
MBS6198543-01 0.1 mL

TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (MaxLight 405)

Sign In for Pricing
View Details
TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (MaxLight 405)
MBS6198543-02 5x 0.1 mL

TWIST1 (Twist Homolog 1 (Drosophila), ACS3, BPES2, BPES3, SCS, Twist, bHLHa38) (MaxLight 405)

Sign In for Pricing
View Details
Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (MaxLight 650)
MBS6224045-01 0.1 mL

Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (MaxLight 650)

Sign In for Pricing
View Details
Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (MaxLight 650)
MBS6224045-02 5x 0.1 mL

Prostatic Acid Phosphatase (PAP, ACPP, ACP3, ACP-3, 5'-Nucleotidase, 5'-NT, Ecto-5'-nucleotidase, Thiamine Monophosphatase, TMPase) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-12/IL-12 Protein
PKSM041070-01 10 µg

Recombinant Mouse Interleukin-12/IL-12 Protein

Sign In for Pricing
View Details