Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACTL8 protein

This Human ACTL8 protein spans the amino acid sequence from region 1-366aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 57 (CT57)

UniProt

Q9H568

Expression Region

1-366aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDAP1 Antibody
orb680155 100 µL

PDAP1 Antibody

Sign In for Pricing
View Details
TRIML1 (Probable E3 Ubiquitin-protein Ligase TRIML1, RING Finger Protein 209, Tripartite Motif Family-like Protein 1, RNF209, FLJ36180, MGC138638, MGC138639) (PE)
134774-PE 100 µL

TRIML1 (Probable E3 Ubiquitin-protein Ligase TRIML1, RING Finger Protein 209, Tripartite Motif Family-like Protein 1, RNF209, FLJ36180, MGC138638, MGC138639) (PE)

Sign In for Pricing
View Details
hsa-miR-624 miRNA Inhibitor
MIH03265 2x 5.0 nmol

hsa-miR-624 miRNA Inhibitor

Sign In for Pricing
View Details
1-Methyl-7-nitroisatoic anhydride
orb1219756-01 100 mg

1-Methyl-7-nitroisatoic anhydride

Sign In for Pricing
View Details
1-Methyl-7-nitroisatoic anhydride
orb1219756-02 200 mg

1-Methyl-7-nitroisatoic anhydride

Sign In for Pricing
View Details
1-Methyl-7-nitroisatoic anhydride
orb1219756-03 500 mg

1-Methyl-7-nitroisatoic anhydride

Sign In for Pricing
View Details