Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACTL8 protein

This Human ACTL8 protein spans the amino acid sequence from region 1-366aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 57 (CT57)

UniProt

Q9H568

Expression Region

1-366aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERO1 Antibody
orb846000 2 mg

ERO1 Antibody

Sign In for Pricing
View Details
PGAM4, NT (PGAM4, PGAM3, Probable phosphoglycerate mutase 4) (MaxLight 750)
MBS6332967-01 0.1 mL

PGAM4, NT (PGAM4, PGAM3, Probable phosphoglycerate mutase 4) (MaxLight 750)

Sign In for Pricing
View Details
PGAM4, NT (PGAM4, PGAM3, Probable phosphoglycerate mutase 4) (MaxLight 750)
MBS6332967-02 5x 0.1 mL

PGAM4, NT (PGAM4, PGAM3, Probable phosphoglycerate mutase 4) (MaxLight 750)

Sign In for Pricing
View Details
CFBP1 polyclonal antibody
orb1495245-01 50 μL

CFBP1 polyclonal antibody

Sign In for Pricing
View Details
CFBP1 polyclonal antibody
orb1495245-02 100 µL

CFBP1 polyclonal antibody

Sign In for Pricing
View Details
CFBP1 polyclonal antibody
orb1495245-03 200 µL

CFBP1 polyclonal antibody

Sign In for Pricing
View Details