Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine PSAP protein

This Porcine PSAP protein spans the amino acid sequence from region 1-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cerebroside sulfate activator (CS-ACT) (Non-specific activator) (Sphingolipid activator protein 1) (SAP-1)

UniProt

P81405

Expression Region

1-80aa

Tag

N-terminal 6xHis-Flag-tagged

Source

Yeast

Origin

Sus scrofa (Pig)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Pan (MHC II) (HLA-Pan/2967R), 0.2mg/mL
BNUB2967-100 1x 100 µL

HLA-Pan (MHC II) (HLA-Pan/2967R), 0.2mg/mL

Sign In for Pricing
View Details
Steady-LucTM Firefly HTS Assay Kit (Lyophilized) 10 x 1000 Assays
#30028-L3 1 Kit

Steady-LucTM Firefly HTS Assay Kit (Lyophilized) 10 x 1000 Assays

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD90 Antibody[5E10]
E-AB-F1167G-01 20 Tests

PE/Cyanine5 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD90 Antibody[5E10]
E-AB-F1167G-02 100 Tests

PE/Cyanine5 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD90 Antibody[5E10]
E-AB-F1167G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
Nitarsone Ammonium Salt
TRC-N489505-1MG 1 mg

Nitarsone Ammonium Salt

Sign In for Pricing
View Details