Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TFF3 protein

This Human TFF3 protein spans the amino acid sequence from region 29-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)

UniProt

Q07654

Expression Region

29-80aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag)
046285-01 200 µg

FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag)

Sign In for Pricing
View Details
FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag)
046285-02 1 mg

FLAG-Tag (DDDDK Epitope Tag, DYKDDDDK Epitope Tag)

Sign In for Pricing
View Details
Mant-N6-Methyl-ATP, S pack
JBS-NU-216S 30 µL

Mant-N6-Methyl-ATP, S pack

Sign In for Pricing
View Details
Rat Anti-human/mouse CD11b/PE-Cy7 antibody
SLM-30153A-PE-Cy7-01 25 Tests

Rat Anti-human/mouse CD11b/PE-Cy7 antibody

Sign In for Pricing
View Details
Rat Anti-human/mouse CD11b/PE-Cy7 antibody
SLM-30153A-PE-Cy7-02 50 Tests

Rat Anti-human/mouse CD11b/PE-Cy7 antibody

Sign In for Pricing
View Details
Rat Anti-human/mouse CD11b/PE-Cy7 antibody
SLM-30153A-PE-Cy7-03 100 Tests - Cy7

Rat Anti-human/mouse CD11b/PE-Cy7 antibody

Sign In for Pricing
View Details