Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus VACWR088 protein

This Virus VACWR088 protein spans the amino acid sequence from region 2-183aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Virion membrane protein M25

UniProt

P07612

Expression Region

2-183aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHERGIL 101 (Adhesive-Polystyrene Medium to High Viscosity)
90023237 1 L

SHERGIL 101 (Adhesive-Polystyrene Medium to High Viscosity)

Sign In for Pricing
View Details
Rabbit β crystallin S (CRYGS) ELISA Kit
GTR10334342 96 Well

Rabbit β crystallin S (CRYGS) ELISA Kit

Sign In for Pricing
View Details
FAM50A Human
PT-A01716-01 5 µg

FAM50A Human

Sign In for Pricing
View Details
FAM50A Human
PT-A01716-02 20 µg

FAM50A Human

Sign In for Pricing
View Details
FAM50A Human
PT-A01716-03 1 mg

FAM50A Human

Sign In for Pricing
View Details
IL-11R alpha, His, Mouse
Z06182-500 500 µg

IL-11R alpha, His, Mouse

Sign In for Pricing
View Details