Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine RHO protein

This Porcine RHO protein spans the amino acid sequence from region 1-36aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RHO1

UniProt

O18766

Expression Region

1-36aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT3A Rabbit Polyclonal Antibody
TA383335 100 µL

WNT3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ALG1L (NM_001015050) Human Over-expression Lysate
LY423116 100 µg

ALG1L (NM_001015050) Human Over-expression Lysate

Sign In for Pricing
View Details
EXOC1 Rabbit Polyclonal Antibody
TA376029 100 µL

EXOC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC6A3 Polyclonal Antibody
E-AB-12361-01 20 µL

SLC6A3 Polyclonal Antibody

Sign In for Pricing
View Details
SLC6A3 Polyclonal Antibody
E-AB-12361-02 60 µL

SLC6A3 Polyclonal Antibody

Sign In for Pricing
View Details
SLC6A3 Polyclonal Antibody
E-AB-12361-03 120 µL

SLC6A3 Polyclonal Antibody

Sign In for Pricing
View Details