Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EGR1 protein

This Human EGR1 protein spans the amino acid sequence from region 444-543aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AT225 (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24) (KROX24) (ZNF225)

UniProt

P18146

Expression Region

444-543aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL12 3'UTR Lenti-reporter-Luc Vector
20289081 1.0 µg

FBXL12 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Protein FAM48A, FAM48A ELISA Kit
MBS9340040-01 48 Well

Mouse Protein FAM48A, FAM48A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM48A, FAM48A ELISA Kit
MBS9340040-02 96 Well

Mouse Protein FAM48A, FAM48A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM48A, FAM48A ELISA Kit
MBS9340040-03 5x 96 Well

Mouse Protein FAM48A, FAM48A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM48A, FAM48A ELISA Kit
MBS9340040-04 10x 96 Well

Mouse Protein FAM48A, FAM48A ELISA Kit

Sign In for Pricing
View Details
VSV-G-Tag Monoclonal Antibody (8D6), AbFluor™ 405 Conjugated
RA12173-01 50 µL

VSV-G-Tag Monoclonal Antibody (8D6), AbFluor™ 405 Conjugated

Sign In for Pricing
View Details