Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EGR1 protein

This Human EGR1 protein spans the amino acid sequence from region 444-543aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AT225 (Nerve growth factor-induced protein A) (NGFI-A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox-24) (KROX24) (ZNF225)

UniProt

P18146

Expression Region

444-543aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin 6 (Syntaxin-6, STX6) (MaxLight 750)
MBS6235619-01 0.1 mL

Syntaxin 6 (Syntaxin-6, STX6) (MaxLight 750)

Sign In for Pricing
View Details
Syntaxin 6 (Syntaxin-6, STX6) (MaxLight 750)
MBS6235619-02 5x 0.1 mL

Syntaxin 6 (Syntaxin-6, STX6) (MaxLight 750)

Sign In for Pricing
View Details
Hspb8 (NM_053612) Rat Tagged ORF Clone Lentiviral Particle
RR202726L3V 200 µL

Hspb8 (NM_053612) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Stat1 mutant oligonucleotide
sc-2574 500 ng - 25 µL

Stat1 mutant oligonucleotide

Sign In for Pricing
View Details
Anti-CD81 Antibody-HRP (8P60)
TMAY-02703H 100 µg

Anti-CD81 Antibody-HRP (8P60)

Sign In for Pricing
View Details
Rabbit anti-DDX51 Antibody
DL99295A-01 50 µL

Rabbit anti-DDX51 Antibody

Sign In for Pricing
View Details