What is the catalog number for Virus ureA protein?

The catalog number for Virus ureA protein is orb604581.

What sizes are available for Virus ureA protein?

Virus ureA protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Virus ureA protein come in?

Virus ureA protein is available in 3 different pack sizes.

Is Virus ureA protein in stock?

Virus ureA protein is currently made to order / not held in immediate stock. Contact us for lead time.

Virus ureA protein

This Virus ureA protein spans the amino acid sequence from region 1-238aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Urea amidohydrolase subunit alpha

UniProt

P14916

Expression Region

1-238aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology; Kidney & Urological Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE