Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus BZLF1 protein

This Virus BZLF1 protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zebra

UniProt

Q3KSS8

Expression Region

1-245aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSAAPTGSWFPAPQPAPENAYQAYAAPQLFPVSDITQNQLTNQAGGEAPQPGDNSTVQPAAAVVLACPGANQEQQLADIGAPQPAPAAAPARRTRKPLQPESLEECDSELEIKRYKNRVASRKCRAKFKHLLQHYREVASAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERN2 Antibody
orb524126-01 50 μL

ERN2 Antibody

Sign In for Pricing
View Details
ERN2 Antibody
orb524126-02 100 µL

ERN2 Antibody

Sign In for Pricing
View Details
Human Cardiolipin ELISA kit
GTR10456910 96 Well

Human Cardiolipin ELISA kit

Sign In for Pricing
View Details
Human FAM25A knockdown cell line
ABC-KD5238 1 Vial

Human FAM25A knockdown cell line

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Squamous Cell Carcinoma Antigen 1 (SCCA1)
MBS2108731-01 0.1 mL

HRP-Linked Polyclonal Antibody to Squamous Cell Carcinoma Antigen 1 (SCCA1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Squamous Cell Carcinoma Antigen 1 (SCCA1)
MBS2108731-02 0.2 mL

HRP-Linked Polyclonal Antibody to Squamous Cell Carcinoma Antigen 1 (SCCA1)

Sign In for Pricing
View Details