Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat S100a4 protein

This Rat S100a4 protein spans the amino acid sequence from region 2-101aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metastasin (Nerve growth factor-induced protein 42A) (P9K) (Placental calcium-binding protein) (S100 calcium-binding protein A4)

UniProt

P05942

Expression Region

2-101aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metapneumovirus (hMPV) (AP)
MBS6260565-01 0.1 mL

Metapneumovirus (hMPV) (AP)

Sign In for Pricing
View Details
Metapneumovirus (hMPV) (AP)
MBS6260565-02 5x 0.1 mL

Metapneumovirus (hMPV) (AP)

Sign In for Pricing
View Details
pCMV-SPORT6-Tada2l Plasmid
PVT58783 2 µg

pCMV-SPORT6-Tada2l Plasmid

Sign In for Pricing
View Details
Chicken Conserved oligomeric Golgi complex subunit 6 (COG6) ELISA kit
GTR10373732 96 Well

Chicken Conserved oligomeric Golgi complex subunit 6 (COG6) ELISA kit

Sign In for Pricing
View Details
Canine Macrophage inflammatory protein 2 ELISA kit
GTR10386190 96 Well

Canine Macrophage inflammatory protein 2 ELISA kit

Sign In for Pricing
View Details
Lentiviral mouse Hip1r shRNA (UAS) - Lentiviral mouse Hip1r shRNA (UAS, GFP) (100)
GTR15199233 1 Vial

Lentiviral mouse Hip1r shRNA (UAS) - Lentiviral mouse Hip1r shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details