Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFA3 protein

This Human DEFA3 protein spans the amino acid sequence from region 39-94aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Defensin, alpha 3 (HNP-3) (HP-3) (HP3) (HP 3-56) (Neutrophil defensin 2) (HNP-2) (HP-2) (HP2) (DEF3)

UniProt

P59666

Expression Region

39-94aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (Phospho Ser432) Polyclonal Antibody
MBS9459102-01 0.05 mL

Cytokeratin 8 (Phospho Ser432) Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (Phospho Ser432) Polyclonal Antibody
MBS9459102-02 0.1 mL

Cytokeratin 8 (Phospho Ser432) Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (Phospho Ser432) Polyclonal Antibody
MBS9459102-03 5x 0.1 mL

Cytokeratin 8 (Phospho Ser432) Polyclonal Antibody

Sign In for Pricing
View Details
2810405K02Rik antibody - middle region
MBS3211047-01 0.1 mL

2810405K02Rik antibody - middle region

Sign In for Pricing
View Details
2810405K02Rik antibody - middle region
MBS3211047-02 5x 0.1 mL

2810405K02Rik antibody - middle region

Sign In for Pricing
View Details
GAS6 (D3A3G) Rabbit Monoclonal Antibody
CST 67202T 20 µL

GAS6 (D3A3G) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details