Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 18-92aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein B5

UniProt

P24284

Expression Region

18-92aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vaccinia virus (strain LC16m8) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROCR Mouse Monoclonal Antibody [Clone ID: OTI12C4]
CF805779 100 µg

PROCR Mouse Monoclonal Antibody [Clone ID: OTI12C4]

Sign In for Pricing
View Details
Recombinant Human Carboxypeptidase M/CPM Protein (His Tag)
PKSH031189 50 µg

Recombinant Human Carboxypeptidase M/CPM Protein (His Tag)

Sign In for Pricing
View Details
Ceruloplasmin Antibody
KC-28816-01 50 μL

Ceruloplasmin Antibody

Sign In for Pricing
View Details
Ceruloplasmin Antibody
KC-28816-02 100 µL

Ceruloplasmin Antibody

Sign In for Pricing
View Details
Ceruloplasmin Antibody
KC-28816-03 1 mL

Ceruloplasmin Antibody

Sign In for Pricing
View Details
ZNF583 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G7]
TA810529BM 100 µL

ZNF583 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G7]

Sign In for Pricing
View Details