Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFA3 protein

This Human DEFA3 protein spans the amino acid sequence from region 39-94aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Defensin, alpha 3 (HNP-3) (HP-3) (HP3) (HP 3-56) (Neutrophil defensin 2) (HNP-2) (HP-2) (HP2) (DEF3)

UniProt

P59666

Expression Region

39-94aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOP3B (Topoisomerase (DNA) III beta, FLJ39376) (MaxLight 490)
252888-ML490 100 µL

TOP3B (Topoisomerase (DNA) III beta, FLJ39376) (MaxLight 490)

Sign In for Pricing
View Details
SMCHD1 Rabbit pAb, PE-Cy5 conjugated
orb2877371 100 µL

SMCHD1 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1217665-01 0.02 mg (E-Coli)

Recombinant Bartonella tribocorum UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1217665-02 0.02 mg (Yeast)

Recombinant Bartonella tribocorum UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1217665-03 0.1 mg (E-Coli)

Recombinant Bartonella tribocorum UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1217665-04 0.1 mg (Yeast)

Recombinant Bartonella tribocorum UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details