Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFA3 protein

This Human DEFA3 protein spans the amino acid sequence from region 39-94aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Defensin, alpha 3 (HNP-3) (HP-3) (HP3) (HP 3-56) (Neutrophil defensin 2) (HNP-2) (HP-2) (HP2) (DEF3)

UniProt

P59666

Expression Region

39-94aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUTA Rabbit pAb, BF700 conjugated
orb2878834 100 µL

CUTA Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r37 shRNA (UAS) - Lentiviral mouse Vmn1r37 shRNA (UAS, iRFP) plasmid
GTR15110764 1 Vial

Lentiviral mouse Vmn1r37 shRNA (UAS) - Lentiviral mouse Vmn1r37 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Cdc37 Antibody
R32244 100 µg

Cdc37 Antibody

Sign In for Pricing
View Details
Taq Polymerase – glycerol-free (1 KU)
JBS-PCR-422-1KU 1 KU

Taq Polymerase – glycerol-free (1 KU)

Sign In for Pricing
View Details
HAUS7 Antibody
orb1320381-01 30 µL

HAUS7 Antibody

Sign In for Pricing
View Details
HAUS7 Antibody
orb1320381-02 50 μL

HAUS7 Antibody

Sign In for Pricing
View Details