Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sprr2b protein

This Mouse Sprr2b protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sprr2bSmall proline-rich protein 2B

UniProt

O70554

Expression Region

1-98aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TJAP1 Rabbit Polyclonal Antibody
BT-AP13040-01 20 µL

TJAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TJAP1 Rabbit Polyclonal Antibody
BT-AP13040-02 50 µL

TJAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TJAP1 Rabbit Polyclonal Antibody
BT-AP13040-03 100 µL

TJAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to TBox Protein 3 (TBX3)
MBS2137497-01 0.1 mL

HRP Linked Monoclonal Antibody to TBox Protein 3 (TBX3)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to TBox Protein 3 (TBX3)
MBS2137497-02 0.2 mL

HRP Linked Monoclonal Antibody to TBox Protein 3 (TBX3)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to TBox Protein 3 (TBX3)
MBS2137497-03 0.5 mL

HRP Linked Monoclonal Antibody to TBox Protein 3 (TBX3)

Sign In for Pricing
View Details