Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sprr2b protein

This Mouse Sprr2b protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sprr2bSmall proline-rich protein 2B

UniProt

O70554

Expression Region

1-98aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP38 (NM_032557) Human Tagged Lenti ORF Clone
RC208974L3 10 µg

USP38 (NM_032557) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PLOD1 Recombinant Protein (Human)
RP083928 100 µg

PLOD1 Recombinant Protein (Human)

Sign In for Pricing
View Details
GBA3 Rabbit pAb (APR27735N)
APR27735N-01 50 µL

GBA3 Rabbit pAb (APR27735N)

Sign In for Pricing
View Details
GBA3 Rabbit pAb (APR27735N)
APR27735N-02 100 µL

GBA3 Rabbit pAb (APR27735N)

Sign In for Pricing
View Details
GBA3 Rabbit pAb (APR27735N)
APR27735N-03 200 µL

GBA3 Rabbit pAb (APR27735N)

Sign In for Pricing
View Details
pLV3-U6-HIF1A-sgRNA2-CAS9-mCherry-Puro Plasmid
PVT61397 2 µg

pLV3-U6-HIF1A-sgRNA2-CAS9-mCherry-Puro Plasmid

Sign In for Pricing
View Details