Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila RpL10 protein

This Drosophila RpL10 protein spans the amino acid sequence from region 1-218aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

QM protein homolog (dQM) (Qm)

UniProt

O61231

Expression Region

1-218aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF640R conjugate, 0.1mg/mL
BNC403017-500 1x 500 µL

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPM2 Polyclonal Antibody
E-AB-15658-01 20 µL

TPM2 Polyclonal Antibody

Sign In for Pricing
View Details
TPM2 Polyclonal Antibody
E-AB-15658-02 60 µL

TPM2 Polyclonal Antibody

Sign In for Pricing
View Details
TPM2 Polyclonal Antibody
E-AB-15658-03 120 µL

TPM2 Polyclonal Antibody

Sign In for Pricing
View Details
TPM2 Polyclonal Antibody
E-AB-15658-04 200 µL

TPM2 Polyclonal Antibody

Sign In for Pricing
View Details
Human TP53INP2 activation kit by CRISPRa
GA111763 1 Kit

Human TP53INP2 activation kit by CRISPRa

Sign In for Pricing
View Details