Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine GH1 protein

This Porcine GH1 protein spans the amino acid sequence from region 1-216aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth hormone

UniProt

P01248

Expression Region

1-216aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KSR1, C-His Tag
HA210518-01 20 µg

Human KSR1, C-His Tag

Sign In for Pricing
View Details
Human KSR1, C-His Tag
HA210518-02 50 µg

Human KSR1, C-His Tag

Sign In for Pricing
View Details
Human KSR1, C-His Tag
HA210518-03 100 µg

Human KSR1, C-His Tag

Sign In for Pricing
View Details
Cep68 Mouse Gene Knockout Kit (CRISPR)
KN503166 1 Kit

Cep68 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR172B Polyclonal Antibody
E-AB-13279-01 20 µL

GPR172B Polyclonal Antibody

Sign In for Pricing
View Details
GPR172B Polyclonal Antibody
E-AB-13279-02 60 µL

GPR172B Polyclonal Antibody

Sign In for Pricing
View Details