Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine GH1 protein

This Porcine GH1 protein spans the amino acid sequence from region 1-216aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth hormone

UniProt

P01248

Expression Region

1-216aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIN1 Human Gene Knockout Kit (CRISPR)
KN402543 1 Kit

PIN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
POLD1 Human Gene Knockout Kit (CRISPR)
KN201238 1 Kit

POLD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HIGD1A (NM_001099669) Human Over-expression Lysate
LC420483 20 µg

HIGD1A (NM_001099669) Human Over-expression Lysate

Sign In for Pricing
View Details
ATF2 pThr69/51 Rabbit Polyclonal Antibody
AP01530PU-N 100 µg

ATF2 pThr69/51 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human EphA2 Protein (His Tag)
PKSH032009-01 10 µg

Recombinant Human EphA2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human EphA2 Protein (His Tag)
PKSH032009-02 50 µg

Recombinant Human EphA2 Protein (His Tag)

Sign In for Pricing
View Details