Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Bmp3 protein

This Mouse Bmp3 protein spans the amino acid sequence from region 359-468aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bmp3Bone morphogenetic protein 3, BMP-3

UniProt

Q8BHE5

Expression Region

359-468aa

Tag

C-terminal myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sytl3 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6445704 1.0 µg DNA

Sytl3 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Treble Frame Set 05 in Grey with Green Trays - EACH
SED1022O 1 Each

Treble Frame Set 05 in Grey with Green Trays - EACH

Sign In for Pricing
View Details
Human SMPX Protein Lysate
MBS8419878-01 0.02 mg

Human SMPX Protein Lysate

Sign In for Pricing
View Details
Human SMPX Protein Lysate
MBS8419878-02 5x 0.02 mg

Human SMPX Protein Lysate

Sign In for Pricing
View Details
ERCC6 polyclonal antibody
BS61035 50ul

ERCC6 polyclonal antibody

Sign In for Pricing
View Details
Huntingtin-associated protein interacting protein (HAPIP) polyclonal antibody
ABP-PAB-10621 100 ug

Huntingtin-associated protein interacting protein (HAPIP) polyclonal antibody

Sign In for Pricing
View Details