Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Bmp3 protein

This Mouse Bmp3 protein spans the amino acid sequence from region 359-468aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bmp3Bone morphogenetic protein 3, BMP-3

UniProt

Q8BHE5

Expression Region

359-468aa

Tag

C-terminal myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH3B Antibody
MBS7124846-01 0.05 mL

IDH3B Antibody

Sign In for Pricing
View Details
IDH3B Antibody
MBS7124846-02 0.1 mL

IDH3B Antibody

Sign In for Pricing
View Details
IDH3B Antibody
MBS7124846-03 5x 0.1 mL

IDH3B Antibody

Sign In for Pricing
View Details
Sfxn1 ORF Vector (Mouse) (pORF)
ORF057139 1.0 µg DNA

Sfxn1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse CD19 / Leu-12 Protein (His Tag), Biotinylated, 1 pack = 20 µg
BAL6497 1 Each

Mouse CD19 / Leu-12 Protein (His Tag), Biotinylated, 1 pack = 20 µg

Sign In for Pricing
View Details
Mouse Transducin-like enhancer protein 2 (TLE2) ELISA Kit
abx549832 96 Tests

Mouse Transducin-like enhancer protein 2 (TLE2) ELISA Kit

Sign In for Pricing
View Details