Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SH3PXD2A protein

This Human SH3PXD2A protein spans the amino acid sequence from region 902-986aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adapter protein TKS5 (Five SH3 domain-containing protein) (SH3 multiple domains protein 1) (Tyrosine kinase substrate with five SH3 domains FISH) (KIAA0418) (SH3MD1) (TKS5)

UniProt

Q5TCZ1

Expression Region

902-986aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)
MBS1262305-01 0.05 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)
MBS1262305-02 0.2 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)
MBS1262305-03 0.05 mg (Baculovirus)

Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)
MBS1262305-04 0.5 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)
MBS1262305-05 0.2 mg (Yeast)

Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)
MBS1262305-06 0.1 mg (Baculovirus)

Recombinant Yersinia pestis bv. Antiqua Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details