Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast RPB5 protein

This Yeast RPB5 protein spans the amino acid sequence from region 1-215aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RPB5, DNA-directed RNA polymerases I, II, and III subunit RPABC1, RNA polymerases I, II, and III subunit ABC1

UniProt

Q9P4B9

Expression Region

1-215aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Kluyveromyces marxianus (Yeast) (Candida kefyr)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CTSK (Cathepsin K) ELISA Kit
E-EL-M0250-01 24 Tests

Mouse CTSK (Cathepsin K) ELISA Kit

Sign In for Pricing
View Details
Mouse CTSK (Cathepsin K) ELISA Kit
E-EL-M0250-02 48 Tests

Mouse CTSK (Cathepsin K) ELISA Kit

Sign In for Pricing
View Details
Mouse CTSK (Cathepsin K) ELISA Kit
E-EL-M0250-03 96 Tests

Mouse CTSK (Cathepsin K) ELISA Kit

Sign In for Pricing
View Details
Fxn Rabbit Polyclonal Antibody
TA363060 100 µL

Fxn Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DHRS7 Polyclonal Antibody
E-AB-52605-01 20 µL

DHRS7 Polyclonal Antibody

Sign In for Pricing
View Details
DHRS7 Polyclonal Antibody
E-AB-52605-02 60 µL

DHRS7 Polyclonal Antibody

Sign In for Pricing
View Details