Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli fimH protein

This E. coli fimH protein spans the amino acid sequence from region 22-300aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FimH, b4320, JW4283Type 1 fimbrin D-mannose specific adhesin, Protein FimH

UniProt

P08191

Expression Region

22-300aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL18RAP Rabbit Polyclonal Antibody
E10G07708 100 µL

IL18RAP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Rab 35 antibody
STJ95296 200 µl

Anti-Rab 35 antibody

Sign In for Pricing
View Details
Lentiviral mouse Mrgpre shRNA (UAS) - Lentiviral mouse Mrgpre shRNA (UAS, GFP) (100)
GTR15254073 1 Vial

Lentiviral mouse Mrgpre shRNA (UAS) - Lentiviral mouse Mrgpre shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Bovine alpha-Glucosidase ELISA Kit
MBS006457-01 48 Well

Bovine alpha-Glucosidase ELISA Kit

Sign In for Pricing
View Details
Bovine alpha-Glucosidase ELISA Kit
MBS006457-02 96 Well

Bovine alpha-Glucosidase ELISA Kit

Sign In for Pricing
View Details
Bovine alpha-Glucosidase ELISA Kit
MBS006457-03 5x 96 Well

Bovine alpha-Glucosidase ELISA Kit

Sign In for Pricing
View Details