Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus EBNA3 protein

This Virus EBNA3 protein spans the amino acid sequence from region 1-138aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epstein-Barr nuclear antigen 3A (EBNA-3A) (EBV nuclear antigen 3A)

UniProt

P12977

Expression Region

1-138aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAHLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPNK, CT (Poly (P) /ATP NAD Kinase, NAD Kinase, NADK) (Azide free) (HRP) discontinued
P5510-30A-HRP 200 µL

PPNK, CT (Poly (P) /ATP NAD Kinase, NAD Kinase, NADK) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
ARHGEF35 Protein Vector (Human) (pPB-N-His)
PV063030 500 ng

ARHGEF35 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
FAM92B CRISPR Knock Out 293T Cell Line (Human)
20214141 1x 10^6 Cells / 1.0 mL

FAM92B CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
TRIB3 (NM_001301201) Human Tagged ORF Clone
RC237888 10 µg

TRIB3 (NM_001301201) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Mouse Galectin-9 Antibody (RG9-1)
T9901A-1171-01 10 mg

Anti-Mouse Galectin-9 Antibody (RG9-1)

Sign In for Pricing
View Details
Anti-Mouse Galectin-9 Antibody (RG9-1)
T9901A-1171-02 1 mg

Anti-Mouse Galectin-9 Antibody (RG9-1)

Sign In for Pricing
View Details