Plant Lolium perenne Pollen allergen Lol p 1 protein
Selected Variant
GTR18884285-01
Size: 20 µg
This Plant Lolium perenne Pollen allergen Lol p 1 protein spans the amino acid sequence from region 24-263aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Allergen Lol p I (Allergen R7) (Allergen, Lol p 1)
UniProt
P14946
Expression Region
24-263aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Lolium perenne (Perennial ryegrass)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
31.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FEK0441-carrier-free 96 Well With Removable Strips
Human MCP-1 PicoKine® Quick ELISA Kit, Carrier-free
Sign In for Pricing
View Details 
BNC042083-100 1x 100 µL
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
M00374-1 100 µg/Vial
Anti-MCM2 Antibody Picoband® (monoclonal, 11C4)
Sign In for Pricing
View Details 
M00398-1-carrier-free 100 µL
Anti-Cytokeratin 5 KRT5 Rabbit Monoclonal Antibody, Carrier-free
Sign In for Pricing
View Details 
BNC681366-500 1x 500 µL
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details