Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus entA protein

This Virus entA protein spans the amino acid sequence from region 25-257aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEA

UniProt

P0A0L2

Expression Region

25-257aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)
MBS2144701-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)
MBS2144701-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)
MBS2144701-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)
MBS2144701-04 1 mL

Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)
MBS2144701-05 5 mL

Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)
MBS2144701-06 5x 5 mL

Biotin-Linked Monoclonal Antibody to Thymic Stromal Lymphopoietin (TSLP)

Sign In for Pricing
View Details