Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A27L protein

This Virus A27L protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

A27L, A30L14 kDa fusion protein

UniProt

P33816

Expression Region

1-110aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oprm1 (NM_001039652) Mouse Tagged Lenti ORF Clone
MR226134L3 10 µg

Oprm1 (NM_001039652) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-human parvin, alpha polyclonal Antibody
MBS713703-01 0.1 mL

Rabbit anti-human parvin, alpha polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human parvin, alpha polyclonal Antibody
MBS713703-02 5x 0.1 mL

Rabbit anti-human parvin, alpha polyclonal Antibody

Sign In for Pricing
View Details
VERYfinder RABBIT reference DNA for meat traces PCR detection kits - heat treated meats extract
PMA12R_HT 1 Each

VERYfinder RABBIT reference DNA for meat traces PCR detection kits - heat treated meats extract

Sign In for Pricing
View Details
Anti-DNA Antibody (202.33)
MBS1568738-01 0.1 mg

Anti-DNA Antibody (202.33)

Sign In for Pricing
View Details
Anti-DNA Antibody (202.33)
MBS1568738-02 1 mg

Anti-DNA Antibody (202.33)

Sign In for Pricing
View Details