Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnc protein

This Mouse Tnc protein spans the amino acid sequence from region 1884-2099aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hexabrachion (Tenascin-C) (TN-C) (Hxb)

UniProt

Q80YX1

Expression Region

1884-2099aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zoxamide
GW7312-500mg 500 mg

Zoxamide

Sign In for Pricing
View Details
5-Aminolevulinate Synthase, Erythroid-Specific, Mitochondrial (ALAS2) Antibody
abx005002-01 20 µL

5-Aminolevulinate Synthase, Erythroid-Specific, Mitochondrial (ALAS2) Antibody

Sign In for Pricing
View Details
5-Aminolevulinate Synthase, Erythroid-Specific, Mitochondrial (ALAS2) Antibody
abx005002-02 100 µL

5-Aminolevulinate Synthase, Erythroid-Specific, Mitochondrial (ALAS2) Antibody

Sign In for Pricing
View Details
5-Aminolevulinate Synthase, Erythroid-Specific, Mitochondrial (ALAS2) Antibody
abx005002-03 2x 100 µL

5-Aminolevulinate Synthase, Erythroid-Specific, Mitochondrial (ALAS2) Antibody

Sign In for Pricing
View Details
Abca7 Mouse siRNA Oligo Duplex (Locus ID 27403)
SR427827 1 Kit

Abca7 Mouse siRNA Oligo Duplex (Locus ID 27403)

Sign In for Pricing
View Details
Rat Peroxisome proliferator-activated receptor gamma ELISA Kit
EK2408 Inquire

Rat Peroxisome proliferator-activated receptor gamma ELISA Kit

Sign In for Pricing
View Details