Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnc protein

This Mouse Tnc protein spans the amino acid sequence from region 1884-2099aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hexabrachion (Tenascin-C) (TN-C) (Hxb)

UniProt

Q80YX1

Expression Region

1884-2099aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish GLULa/b Antibody Picoband® Fluoro594 Conjugated
AZQ7T2P7-Fluoro594 100 µg/Vial

Anti-Zebrafish GLULa/b Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Creatine Kinase, Muscle (CKM) Magnetic Fluorescence Assay Kit
MBS2154828-01 96 Tests

Creatine Kinase, Muscle (CKM) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Creatine Kinase, Muscle (CKM) Magnetic Fluorescence Assay Kit
MBS2154828-02 5x 96 Tests

Creatine Kinase, Muscle (CKM) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Creatine Kinase, Muscle (CKM) Magnetic Fluorescence Assay Kit
MBS2154828-03 10x 96 Tests

Creatine Kinase, Muscle (CKM) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SPTLC1 Antibody [DyLight 650]
NBP2-81928C 0.1 mL

Rabbit Polyclonal SPTLC1 Antibody [DyLight 650]

Sign In for Pricing
View Details
Fish C-Type Lectin Domain Family 14, Member A (CLEC14A) ELISA Kit
MBS9901517 Inquire

Fish C-Type Lectin Domain Family 14, Member A (CLEC14A) ELISA Kit

Sign In for Pricing
View Details