Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnc protein

This Mouse Tnc protein spans the amino acid sequence from region 1884-2099aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hexabrachion (Tenascin-C) (TN-C) (Hxb)

UniProt

Q80YX1

Expression Region

1884-2099aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MED23 siRNA
abx923856-01 15 nmol

Human MED23 siRNA

Sign In for Pricing
View Details
Human MED23 siRNA
abx923856-02 30 nmol

Human MED23 siRNA

Sign In for Pricing
View Details
DEPDC1 Polyclonal Antibody, Cy5 Conjugated
bs-6525R-Cy5 100 µL

DEPDC1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
EPM2AIP1 Peptide - middle region
orb2001469 100 µg

EPM2AIP1 Peptide - middle region

Sign In for Pricing
View Details
Mouse Monoclonal Influenza A H1N1/H3N2 M1 Antibody (GA2B) [DyLight 594]
NB100-66552DL594 0.5 mL

Mouse Monoclonal Influenza A H1N1/H3N2 M1 Antibody (GA2B) [DyLight 594]

Sign In for Pricing
View Details
Pygl 3'UTR GFP Stable Cell Line
TU167351 1.0 mL

Pygl 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details