Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate IL4 protein

This Primate IL4 protein spans the amino acid sequence from region 25-153aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1 (BSF-1) (Lymphocyte stimulatory factor 1)

UniProt

P79339

Expression Region

25-153aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (Cyclopropylaminocarbonyl) phenylboronic acid, pinacol ester
429466-01 100 mg

4- (Cyclopropylaminocarbonyl) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
4- (Cyclopropylaminocarbonyl) phenylboronic acid, pinacol ester
429466-02 250 mg

4- (Cyclopropylaminocarbonyl) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
Rat interleukin receptor associated kinase 3 (IRAK3) ELISA Kit
YP-W35126-01 48 Tests

Rat interleukin receptor associated kinase 3 (IRAK3) ELISA Kit

Sign In for Pricing
View Details
Rat interleukin receptor associated kinase 3 (IRAK3) ELISA Kit
YP-W35126-02 96 Tests

Rat interleukin receptor associated kinase 3 (IRAK3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycoplasma gallisepticum Cysteine--tRNA ligase (cysS)
MBS1375865-01 0.02 mg (E-Coli)

Recombinant Mycoplasma gallisepticum Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Mycoplasma gallisepticum Cysteine--tRNA ligase (cysS)
MBS1375865-02 0.02 mg (Yeast)

Recombinant Mycoplasma gallisepticum Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details