Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sag protein

This Mouse Sag protein spans the amino acid sequence from region 1-403aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

48 kDa protein (Retinal S-antigen) (S-AG) (Rod photoreceptor arrestin)

UniProt

P20443

Expression Region

1-403aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESVQDENLVFEEFARQNLKDTGENTEGKKDEDAGQDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A1 Antibody
CSB-PA224994 100 µL

S100A1 Antibody

Sign In for Pricing
View Details
pLVX-CMV-USP20-HA-IRES-Neo Plasmid
PVT33460 2 µg

pLVX-CMV-USP20-HA-IRES-Neo Plasmid

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS541889 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Rat Kisspeptin ELISA Kit
GTR10314103 96 Well

Rat Kisspeptin ELISA Kit

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Putative SET domain-containing protein L678 (MIMI_L678)
MBS1460396-01 0.02 mg (E-Coli)

Recombinant Acanthamoeba polyphaga mimivirus Putative SET domain-containing protein L678 (MIMI_L678)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Putative SET domain-containing protein L678 (MIMI_L678)
MBS1460396-02 0.02 mg (Yeast)

Recombinant Acanthamoeba polyphaga mimivirus Putative SET domain-containing protein L678 (MIMI_L678)

Sign In for Pricing
View Details