Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTPRZ1 protein

This Human PTPRZ1 protein spans the amino acid sequence from region 36-300aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein-tyrosine phosphatase receptor type Z polypeptide 1 (Protein-tyrosine phosphatase receptor type Z polypeptide 2) (R-PTP-zeta-2) (HTPZP2) (PTPRZ) (PTPRZ2) (PTPZ)

UniProt

P23471

Expression Region

36-300aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO40 (F-box Only Protein 40, Muscle Disease-related Protein, FBX40, KIAA1195, MGC129902, MGC129903) (MaxLight 490)
126699-ML490 100 µL

FBXO40 (F-box Only Protein 40, Muscle Disease-related Protein, FBX40, KIAA1195, MGC129902, MGC129903) (MaxLight 490)

Sign In for Pricing
View Details
Topoisomerase I Rabbit Polyclonal Antibody (BF405)
orb2446408 100 µL

Topoisomerase I Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Uncharacterized protein yubG (L7076, ECO57PM40)
MBS1249780-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Uncharacterized protein yubG (L7076, ECO57PM40)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Uncharacterized protein yubG (L7076, ECO57PM40)
MBS1249780-02 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 Uncharacterized protein yubG (L7076, ECO57PM40)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Uncharacterized protein yubG (L7076, ECO57PM40)
MBS1249780-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Uncharacterized protein yubG (L7076, ECO57PM40)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Uncharacterized protein yubG (L7076, ECO57PM40)
MBS1249780-04 0.1 mg (Yeast)

Recombinant Escherichia coli O157:H7 Uncharacterized protein yubG (L7076, ECO57PM40)

Sign In for Pricing
View Details