Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LAMB1 protein

This Human LAMB1 protein spans the amino acid sequence from region 1533-1782aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Laminin B1 chain (Laminin-1 subunit beta) (Laminin-10 subunit beta) (Laminin-12 subunit beta) (Laminin-2 subunit beta) (Laminin-6 subunit beta) (Laminin-8 subunit beta)

UniProt

P07942

Expression Region

1533-1782aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxsr1, NT (Oxsr1, Osr1, Serine/threonine-protein kinase OSR1, Oxidative stress-responsive 1 protein)
039555 200 µL

Oxsr1, NT (Oxsr1, Osr1, Serine/threonine-protein kinase OSR1, Oxidative stress-responsive 1 protein)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051762-01 0.1 mL

PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051762-02 0.2 mL

PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051762-03 0.5 mL

PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051762-04 1 mL

PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051762-05 5 mL

PE-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details