Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria BB3856 protein

This Bacteria BB3856 protein spans the amino acid sequence from region 22-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BB3856Azurin

UniProt

P0A321

Expression Region

22-150aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PZP ELISA Kit (Human)
OKEH04635-96W 96 Well

PZP ELISA Kit (Human)

Sign In for Pricing
View Details
CKS2 Human siRNA Oligo Duplex (Locus ID 1164)
SR300837 1 Kit

CKS2 Human siRNA Oligo Duplex (Locus ID 1164)

Sign In for Pricing
View Details
POLD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1680405 3x 1.0 µg

POLD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans trr-1 Polyclonal Antibody
MBS7191653 Inquire

Rabbit anti-Caenorhabditis elegans trr-1 Polyclonal Antibody

Sign In for Pricing
View Details
Trans-Stilbene oxide
sc-255680 1 g

Trans-Stilbene oxide

Sign In for Pricing
View Details
ARL8B Protein Vector (Human) (pPM-C-HA)
PV002499 500 ng

ARL8B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details