Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria BB3856 protein

This Bacteria BB3856 protein spans the amino acid sequence from region 22-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BB3856Azurin

UniProt

P0A321

Expression Region

22-150aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF675 (NM_138330) AAV Particle
RC214834A1V 250 µL

Human ZNF675 (NM_138330) AAV Particle

Sign In for Pricing
View Details
Rabbit Polyclonal CRAT Antibody
NBP1-86615 0.1 mL

Rabbit Polyclonal CRAT Antibody

Sign In for Pricing
View Details
CKI-gamma 3 Antibody / Csnk1g3
F54677-0.08ML 0.08 mL

CKI-gamma 3 Antibody / Csnk1g3

Sign In for Pricing
View Details
Anti-ABCE1 Antibody Picoband®, Cy3 Conjugate
A04173-Cy3 100 µg/Vial

Anti-ABCE1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
CEACAM1, Mouse (HEK293, Fc)
HY-P75360 1 Each

CEACAM1, Mouse (HEK293, Fc)

Sign In for Pricing
View Details
Anti-PU.1/Spi1 Antibody (Dylight488 Conjugate)
RP1097-Dylight488 100 µg

Anti-PU.1/Spi1 Antibody (Dylight488 Conjugate)

Sign In for Pricing
View Details