Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1R1, Mouse (HEK293, His)

IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM) [1]. IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway[4]. IL-1R1 Protein, Mouse (HEK293, His) is a recombinant mouse extracellular region of IL-1R1 (L20-K338) with a C terminal 6*His tag, which is produced in HEK293 cells.

Product Specifications

Product Name Alternative

IL-1R1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1r1-protein-mouse-hek293-his.html

Purity

98.0

Smiles

LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFK

Molecular Formula

16177 (Gene_ID) P13504 (L20-K338) (Accession)

Molecular Weight

50-90 kDa

References & Citations

[1]Diana Boraschi, et al. The family of the interleukin-1 receptors. Immunol Rev. 2018 Jan;281 (1) :197-232.|[2]Daniel P Nemeth, et al. Modulation of Neural Networks by Interleukin-1. Brain Plast. 2021 Aug 23;7 (1) :17-32.|[3]Naoe Kaneko, et al. The role of interleukin-1 in general pathology. Inflamm Regen. 2019 Jun 6;39:12.|[4]Yonggang Sha, et al. A role of IL-1R1 signaling in the differentiation of Th17 cells and the development of autoimmune diseases. Self Nonself. 2011 Jan;2 (1) :35-42.|[5]Xiang Chu, et al. Coupling Between Interleukin-1R1 and Necrosome Complex Involves in Hemin-Induced Neuronal Necroptosis After Intracranial Hemorrhage. Stroke. 2018 Oct;49 (10) :2473-2482.|[6]Siri Tahtinen, et al. IL-1 and IL-1ra are key regulators of the inflammatory response to RNA vaccines. Nat Immunol. 2022 Apr;23 (4) :532-542.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-300-3p miRNA Agomir
abx882676-01 5 nmol

Mouse mmu-miR-300-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-300-3p miRNA Agomir
abx882676-02 10 nmol

Mouse mmu-miR-300-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse hepatitis B virus e antibody,HBeAb ELISA Kit
CN-02518M1 96T

Mouse hepatitis B virus e antibody,HBeAb ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CXorf61
MBS7613604-01 0.05 mg

Recombinant Human CXorf61

Sign In for Pricing
View Details
Recombinant Human CXorf61
MBS7613604-02 0.2 mg

Recombinant Human CXorf61

Sign In for Pricing
View Details
Recombinant Human CXorf61
MBS7613604-03 1 mg

Recombinant Human CXorf61

Sign In for Pricing
View Details