Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNASE4 protein

This Human RNASE4 protein spans the amino acid sequence from region 29-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNS4

UniProt

P34096

Expression Region

29-147aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VEGFA (suvemcitug biosimilar) mAb
MBS1881741-01 0.05 mg

Anti-VEGFA (suvemcitug biosimilar) mAb

Sign In for Pricing
View Details
Anti-VEGFA (suvemcitug biosimilar) mAb
MBS1881741-02 0.1 mg

Anti-VEGFA (suvemcitug biosimilar) mAb

Sign In for Pricing
View Details
Anti-VEGFA (suvemcitug biosimilar) mAb
MBS1881741-03 5x 0.1 mg

Anti-VEGFA (suvemcitug biosimilar) mAb

Sign In for Pricing
View Details
THRAP3 Antibody - N-terminal region (ARP38564_P050)
ARP38564_P050 100 µL

THRAP3 Antibody - N-terminal region (ARP38564_P050)

Sign In for Pricing
View Details
Human ZNF391 knockdown cell line
ABC-KD17516 1 Vial

Human ZNF391 knockdown cell line

Sign In for Pricing
View Details
RASGRF2 AAV siRNA Pooled Vector
38539161 1.0 µg

RASGRF2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details