Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GSTP1 protein

This Human GSTP1 protein spans the amino acid sequence from region 2-210aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST class-piGSTP1-1

UniProt

P09211

Expression Region

2-210aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOG Rabbit Polyclonal Antibody (BF405)
orb2558338 100 µL

MOG Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Sodium sulfite anhydrous p.A.
LC-4110.1 250 g

Sodium sulfite anhydrous p.A.

Sign In for Pricing
View Details
TTPA Protein Vector (Rat) (pPB-C-His)
PV313646 500 ng

TTPA Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Geobacillus thermodenitrificans Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1060315-01 0.02 mg (E-Coli)

Recombinant Geobacillus thermodenitrificans Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details
Recombinant Geobacillus thermodenitrificans Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1060315-02 0.02 mg (Yeast)

Recombinant Geobacillus thermodenitrificans Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details
Recombinant Geobacillus thermodenitrificans Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1060315-03 0.1 mg (E-Coli)

Recombinant Geobacillus thermodenitrificans Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details