Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Glucocorticoid Receptor protein

This Human Glucocorticoid Receptor protein spans the amino acid sequence from region 521-777aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear receptor subfamily 3 group C member 1 GRL

UniProt

P04150

Expression Region

521-777aa

Tag

N-terminal 6xHis-Trx-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL6R/Il 6 R Alpha Picoband Antibody
MBS1750643-01 0.01 mg

Anti-IL6R/Il 6 R Alpha Picoband Antibody

Sign In for Pricing
View Details
Anti-IL6R/Il 6 R Alpha Picoband Antibody
MBS1750643-02 0.1 mg (Carrier Free)

Anti-IL6R/Il 6 R Alpha Picoband Antibody

Sign In for Pricing
View Details
Anti-IL6R/Il 6 R Alpha Picoband Antibody
MBS1750643-03 0.1 mg

Anti-IL6R/Il 6 R Alpha Picoband Antibody

Sign In for Pricing
View Details
Anti-IL6R/Il 6 R Alpha Picoband Antibody
MBS1750643-04 0.1 mg (Cy3)

Anti-IL6R/Il 6 R Alpha Picoband Antibody

Sign In for Pricing
View Details
Anti-IL6R/Il 6 R Alpha Picoband Antibody
MBS1750643-05 0.1 mg (Biotin)

Anti-IL6R/Il 6 R Alpha Picoband Antibody

Sign In for Pricing
View Details
Anti-IL6R/Il 6 R Alpha Picoband Antibody
MBS1750643-06 0.1 mg (HRP)

Anti-IL6R/Il 6 R Alpha Picoband Antibody

Sign In for Pricing
View Details