Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep B2M protein

This Sheep B2M protein spans the amino acid sequence from region 21-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B2MBeta-2-microglobulin

UniProt

Q6QAT4

Expression Region

21-118aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epratuzumab Human Monoclonal Antibody
orb2976335-01 100 µg

Epratuzumab Human Monoclonal Antibody

Sign In for Pricing
View Details
Epratuzumab Human Monoclonal Antibody
orb2976335-02 1 mg

Epratuzumab Human Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pcsk7 shRNA (UAS) - Lentiviral mouse Pcsk7 shRNA (UAS, iRFP) (100)
GTR15244023 1 Vial

Lentiviral mouse Pcsk7 shRNA (UAS) - Lentiviral mouse Pcsk7 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
DNTT Rabbit Polyclonal Antibody (APC)
orb993525 100 µL

DNTT Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 tRNA sulfurtransferase (thiI)
MBS1045727-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O127:H6 tRNA sulfurtransferase (thiI)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 tRNA sulfurtransferase (thiI)
MBS1045727-02 0.02 mg (Yeast)

Recombinant Escherichia coli O127:H6 tRNA sulfurtransferase (thiI)

Sign In for Pricing
View Details