Sheep B2M protein
This Sheep B2M protein spans the amino acid sequence from region 21-118aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
B2MBeta-2-microglobulin
UniProt
Q6QAT4
Expression Region
21-118aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Ovis aries (Sheep)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0026736 96 Tests
Multiplex Assay Kit for Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
Sign In for Pricing
View Details 
C2262-53B 100 µL
CD11b/c (CD11 Antigen-like Family Member C, CD11b, CD11b Antigen, CD11c, Cell Surface Glycoprotein MAC-1 alpha Subunit, Complement Component Receptor 3 alpha, CR3 alpha Chain, CR-3 alpha Chain, CR3A, Integrin alpha M Complement Component 3 Receptor 3 Subunit, ITGAM, Integrin alpha X, ITGAX, Leukocyte Adhesion Receptor MO1, MAC1, MAC-1, MAC1A, MGC117044, MO1A, Neutrophil Adherence Receptor) (Biotin)
Sign In for Pricing
View Details MBS1145969-01 0.02 mg (E-Coli)
Recombinant Escherichia coli O6 Type-1 fimbrial protein, C chain (pilC)
Sign In for Pricing
View Details